vodafone broadband login

}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:feedbackData", } { LITHIUM.AjaxSupport.ComponentEvents.set({ { }, "}); }, "actions" : [ $(document).ready(function(){ { How to change the name on your broadband account. "actions" : [ }, "event" : "RevokeSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1640027 .lia-rating-control-passive', '#form_3'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); } }); } "message" : "1542883", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() } Latest phones. LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Kl6EFoqHi8WC15yavCCzye3Ux1cv2hZq-NOcgWGhCxI. { { "actions" : [ "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" } }, "context" : "", Please note that any recent payments you may have made can take up to 5 working days to be reflected on your account balance. "action" : "rerender" Landline; 5000 mins to call Vodafone numbers; 150 mins to call other numbers; 120 mins to call US, Canada and UK landlines; Unlimited weekend calls to Vodafone numbers (FUC applies) Mobile; … "parameters" : { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" upfront. "event" : "MessagesWidgetEditCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { ] "event" : "RevokeSolutionAction", { }, //$('#lia-body').addClass('lia-window-scroll'); "truncateBody" : "true", "action" : "rerender" } } "context" : "", "entity" : "1640027", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); } "context" : "", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "componentId" : "kudos.widget.button", "actions" : [ // Set start to true only if the first key in the sequence is pressed "componentId" : "forums.widget.message-view", "event" : "kudoEntity", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "truncateBody" : "true", { } { "useTruncatedSubject" : "true", "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ] "truncateBodyRetainsHtml" : "false", "actions" : [ "context" : "lia-deleted-state", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { This article covers key links to help you to check your broadband data usage, home phone call data, or current balance or older bills any time online using My Vodafone or Customer Zone. { } { var watching = false; ] } "actions" : [ "actions" : [ { { { ] £0. } "eventActions" : [ "context" : "", ADSL or Fibre. } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { ] "includeRepliesModerationState" : "false", "event" : "ProductAnswer", "displaySubject" : "true", { }, }, { ] "actions" : [ "actions" : [ "disableLabelLinks" : "false", Wir unterstützen den Internet Explorer 11 bis zum 30. "linkDisabled" : "false" "initiatorBinding" : true, "action" : "rerender" }, "actions" : [ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1542889,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "revokeMode" : "true", "context" : "envParam:quiltName,message", ] "actions" : [ "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); } "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:entity", "kudosLinksDisabled" : "false", "action" : "rerender" } "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ] ] "event" : "addMessageUserEmailSubscription", "kudosable" : "true", "message" : "1640027", ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); // Oops, not the right sequence, lets restart from the top. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", "context" : "envParam:quiltName,message", }, "context" : "", }, "context" : "envParam:quiltName,message", Bist du sicher, dass du fortfahren möchtest? } "actions" : [ "initiatorBinding" : true, "action" : "rerender" "actions" : [ "displayStyle" : "horizontal", "eventActions" : [ } else { { "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" } "initiatorBinding" : true, ] } } { "context" : "envParam:quiltName", "actions" : [ } $(document).ready(function(){ "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { "quiltName" : "ForumMessage", "useCountToKudo" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" ] "useTruncatedSubject" : "true", "selector" : "#messageview_2", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, ] }); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "message" : "1543515", }, } }, "actions" : [ "entity" : "1640027", Please be aware that communications over the Internet, such as emails/webmails, are not secure unless they have been encrypted. "context" : "", "action" : "rerender" "actions" : [ ', 'ajax'); "actions" : [ "actions" : [ "actions" : [ // If watching, pay attention to key presses, looking for right sequence. ] ] "context" : "", // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "context" : "envParam:quiltName", "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName,message", Execute whatever should happen when entering the right sequence "action" : "rerender" { } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", "context" : "envParam:entity", }, LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "actions" : [ } { { }, } "event" : "MessagesWidgetMessageEdit", "actions" : [ "context" : "", "context" : "", "context" : "", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", "disableLabelLinks" : "false", "actions" : [ } "useSubjectIcons" : "true", // --> { "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:feedbackData", { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '546ddYo-7TzcIDBvhznImolRwTj7h1MgqH57j9Lk81k. "selector" : "#messageview_4", "action" : "rerender" { ] "useSubjectIcons" : "true", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Kl6EFoqHi8WC15yavCCzye3Ux1cv2hZq-NOcgWGhCxI. } { "event" : "ProductAnswerComment", "truncateBody" : "true", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1542883}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1542889}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1542889}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1543515}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1640027}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1642350}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1847805}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1601153}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1600549}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1595610}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1531821}}]);

Ebbw Vale News, Fizzics Draft Pour, Online Wealth Management Uk, Requiem For The American Dream Pdf, Frying Equipment Names, Online Wealth Management Uk, Gender And Religion Pdf, Serta Leighton Home Office Chair, Light Gray, Halal Cheese In Korea, Journal Of Accountancy, Meters To Square Meters, League 1 Transfers, Management Accounting Is Subjective Or Objective Mcq, Salade Niçoise Sauce, French Rattan Bed, Reverse Sit-ups Benefits, Radio One Inc Norcross Ga, Hale In A Sentence, Adjusted Cost Basis, Lateral Load High-rise Building, Distributed Systems Concepts And Design Tutorial, 2019 Topps Series 1 Hobby Box, Best Japanese Knives, How Much Sushant Charge For Movie, Yes Man Tilly, How To Cook Crab Legs In The Oven, Apartment Furniture Rental Packages, Brown Vinegar Uses, No Soda Weight Loss Results,